PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.G3ZLR
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 321aa    MW: 36695.1 Da    PI: 5.0321
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.G3ZLRgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.2e-5661351129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+e+d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++ 
  Araip.G3ZLR   6 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIREIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD- 101
                  69****************************.9***************953432233667**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  k +l+g++ktLvfykgrap+g+ktdW+mheyrle
  Araip.G3ZLR 102 KAKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 135
                  999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-593166IPR003441NAC domain
PROSITE profilePS5100558.5766166IPR003441NAC domain
PfamPF023654.0E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MESSCVPPGF RFHPTDEELV GYYLRKKVAS QKIDLDVIRE IDLYRIEPWD LQERCRIGYE  60
EQNEWYFFSH KDKKYPTGTR TNRATMAGFW KATGRDKAVY DKAKLIGMRK TLVFYKGRAP  120
NGQKTDWIMH EYRLESDENG PPQASLLDYL YYVYEEGWVV CRAFKKRTTN GQTKTMEGWD  180
SSYLYEEGSG GGGGPNMHAN IAAEQFVQLP QLESPSLPLV KRPTTSTMAL VSESNEDHNM  240
LSKKVVTDWR DLDKFVASQL SHGGDSSRHE TETDDAAVLP SFMDNNNHDN SDSISDMLMM  300
SMSPFLNTSS DCDIGICVFE N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-51616815170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150438e-53AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016201939.10.0PREDICTED: NAC domain-containing protein 37
RefseqXP_016201940.10.0PREDICTED: NAC domain-containing protein 37
SwissprotQ9SL411e-137NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A0B2RW611e-154A0A0B2RW61_GLYSO; NAC domain-containing protein 7
TrEMBLA0A151QRF71e-154A0A151QRF7_CAJCA; NAC domain-containing protein 7
STRINGPOPTR_0007s13910.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-123vascular related NAC-domain protein 1